Novus Biologicals
Manufacturer Code:NBP214236
Catalog # NBP214236
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDG DGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B; alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase; alpha-13-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B alpha-13-mannosyl-glycoprotein beta-14-N-acetylglucosaminyltransferase aminyltransferase EC 2.4.1.145 GlcNAc-T IVb GNT-IV GNT-IVB isoenzyme B isozyme B mannosyl (alpha-13-)-glycoprotein beta-14-N-acetylglucosaminyltransferase N-acetylglucosaminyltransferase IVb N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb UDP-N-acetylglucosamine: alpha-13-D-mannosidebeta-14-N-acetylglucosaminyltransferase IV UDP-N-acetylglucosamine: alpha-13-D-mannosidebeta-14-N-acetylglucosaminyltransferase IVb; aminyltransferase; GlcNAc-T IVb; mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isoenzyme B; N-acetylglucosaminyltransferase IVb; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb; UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IV; UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVb
Gene Aliases: GNT-IV; GNT-IVB; MGAT4B; UNQ906/PRO1927
UniProt ID: (Human) Q9UQ53
Entrez Gene ID: (Human) 11282
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.