Novus Biologicals
Manufacturer Code:NBP170635
Catalog # NBP170635
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C1ORF184 The peptide sequence was selected from the C terminal of C1ORF184. Peptide sequence NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha N-terminal protein methyltransferase 1B; C1orf184 methyltransferase like 11B methyltransferase-like protein 11B NTM1B X-Pro-Lys N-terminal protein methyltransferase 1B; Methyltransferase-like protein 11B; NTM1B; X-Pro-Lys N-terminal protein methyltransferase 1B
Gene Aliases: C1orf184; HOMT1B; METTL11B; NRMT2; NTM1B
UniProt ID: (Human) Q5VVY1
Entrez Gene ID: (Human) 149281
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.