Novus Biologicals
Manufacturer Code:NBP15492820UL
Catalog # NBP15492820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to METTL1(methyltransferase like 1) The peptide sequence was selected from the middle region of METTL1. Peptide sequence KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C12orf1 D1075-like gene product EC 2.1.1.33 FLJ95748 methyltransferase like 1 methyltransferase-like 1 Methyltransferase-like protein 1 TRM8 tRNA (guanine-N(7)-)-methyltransferase tRNA(m7G46)-methyltransferase YDL201w; D1075-like gene product; Methyltransferase-like protein 1; METTL1; miRNA (guanine-N(7)-)-methyltransferase; mRNA (guanine-N(7)-)-methyltransferase; tRNA (guanine(46)-N(7))-methyltransferase; tRNA (guanine-N(7)-)-methyltransferase; tRNA(m7G46)-methyltransferase
Gene Aliases: C12orf1; METTL1; TRM8; TRMT8; YDL201w
UniProt ID: (Human) Q9UBP6
Entrez Gene ID: (Human) 4234
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.