Novus Biologicals
Manufacturer Code:NBP179256
Catalog # NBP179256
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human METT10D. Peptide sequence: ALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1.- methyltransferase 10 domain containing Methyltransferase 10 domain-containing protein methyltransferase like 16 METT10D MGC3329 putative methyltransferase METT10D; methyltransferase 10 domain containing; Methyltransferase 10 domain-containing protein; Methyltransferase-like protein 16; N6-adenosine-methyltransferase METTL16; putative methyltransferase METT10D; RNA N6-adenosine-methyltransferase METTL16; U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
Gene Aliases: METT10D; METTL16
UniProt ID: (Human) Q86W50
Entrez Gene ID: (Human) 79066
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.