Novus Biologicals
Manufacturer Code:NBP189654
Catalog # NBP189654
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Dual specificity mitogen-activated protein kinase kinase 5; HsT17454 MAP kinase kinase 5 MAP kinase kinase MEK5b MAPK/ERK kinase 5 MAPKK 5 MAPKK5EC 2.7.12.2 MEK5MEK 5 mitogen-activated protein kinase kinase 5 MKK5 PRKMK5dual specificity mitogen-activated protein kinase kinase 5; MAP kinase kinase 5; MAP kinase kinase MEK5b; MAPK/ERK kinase 5; MAPKK 5; MEK 5
Gene Aliases: HsT17454; MAP2K5; MAPKK5; MEK5; MKK5; PRKMK5
UniProt ID: (Human) Q13163
Entrez Gene ID: (Human) 5607
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.