Novus Biologicals
Manufacturer Code:NBP238776
Catalog # NBP238776
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Homeobox protein Meis1; homeobox protein Meis1 leukemogenic homolog protein Meis homeobox 1 MGC43380 myeloid ecotropic viral integration site 1 homolog myeloid ecotropic viral integration site 1 homolog (mouse); leukemogenic homolog protein; Meis1, myeloid ecotropic viral integration site 1 homolog; WUGSC:H_NH0444B04.1
Gene Aliases: MEIS1
UniProt ID: (Human) O00470
Entrez Gene ID: (Human) 4211
Molecular Function:
DNA-directed RNA polymerase
RNA binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.