Novus Biologicals
Manufacturer Code:NBP258539
Catalog # NBP258539
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADCAD1 MADS box transcription enhancer factor 2 polypeptide A (myocyte enhancerfactor 2A) MEF2 myocyte enhancer factor 2A myocyte-specific enhancer factor 2A RSRFC4 RSRFC9 Serum response factor-like protein 1; MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancer factor 2A); Myocyte-specific enhancer factor 2A; Serum response factor-like protein 1
Gene Aliases: ADCAD1; MEF2; MEF2A; RSRFC4; RSRFC9
UniProt ID: (Human) Q96D14
Entrez Gene ID: (Human) 4205
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.