Novus Biologicals
Manufacturer Code:NBP238118
Catalog # NBP238118
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Activator-recruited cofactor 33 kDa component; Activator-recruited cofactor 33 kDa component ARC33 mediator complex subunit 6hMed6 mediator of RNA polymerase II transcription subunit 6 mediator of RNA polymerase II transcription subunit 6 homolog mediator of RNA polymerase II transcription subunit 6 homolog (S. cerevisiae) NY-REN-28 Renal carcinoma antigen NY-REN-28; ARC33; CTD-2540L5.5; hMed6; Mediator complex subunit 6; Mediator of RNA polymerase II transcription subunit 6; Renal carcinoma antigen NY-REN-28
Gene Aliases: ARC33; MED6; NY-REN-28
UniProt ID: (Human) O75586
Entrez Gene ID: (Human) 10001
Molecular Function:
transcription cofactor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.