Novus Biologicals
Manufacturer Code:NBP185104
Catalog # NBP185104
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZP434N185 EG1DKFZp434N185 magicin mediator complex subunit 281500003D12Rik mediator of RNA polymerase II transcription subunit 28 homolog (S. cerevisiae) subunit 28 homolog; endothelial-derived gene 1; Endothelial-derived protein 1; Magicin; Mediator complex subunit 28; Mediator of RNA polymerase II transcription subunit 28; mediator of RNA polymerase II transcription, subunit 28 homolog; Merlin and Grb2-interacting cytoskeletal protein; Tumor angiogenesis marker EG-1
Gene Aliases: 1500003D12Rik; EG1; FKSG20; magicin; MED28
UniProt ID: (Human) Q9H204
Entrez Gene ID: (Human) 80306
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.