Novus Biologicals
Manufacturer Code:NBP17991020UL
Catalog # NBP17991020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is MECR. Peptide sequence AKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-enoyl thioester reductase; CGI-63 EC 1.3.1.38 FASN2B homolog of yeast 2-enoyl thioester reductase HsNrbf-1 mitochondrial 2-enoyl thioester reductase mitochondrial trans-2-enoyl-CoA reductase NBRF1 NRBF-1 NRBF1hsNrbf-1 nuclear receptor binding factor 1 Nuclear receptor-binding factor 1 trans-2-enoyl-CoA reductase mitochondrial; Enoyl-[acyl-carrier-protein] reductase, mitochondrial; homolog of yeast 2-enoyl thioester reductase; HsNrbf-1; mitochondrial 2-enoyl thioester reductase; nuclear receptor binding factor 1; Nuclear receptor-binding factor 1
Gene Aliases: CGI-63; FASN2B; MECR; NBRF1; NRBF1
UniProt ID: (Human) Q9BV79
Entrez Gene ID: (Human) 51102
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.