Novus Biologicals
Manufacturer Code:NBP15937620UL
Catalog # NBP15937620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MDM1(Mitochondrial deafness modifier 1) The peptide sequence was selected from the N terminal of MDM1. Peptide sequence GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ95264 Mdm1 nuclear protein homolog (mouse) Mdm4 transformed 3T3 cell double minute 1 p53 binding protein Mdm4 transformed 3T3 cell double minute 1 p53 binding protein (mouse) nuclear protein double minute 1 nuclear protein MDM1; Mdm1 nuclear protein homolog; Mdm4, transformed 3T3 cell double minute 1, p53 binding protein; nuclear protein double minute 1; Nuclear protein MDM1
Gene Aliases: MDM1
UniProt ID: (Human) Q8TC05
Entrez Gene ID: (Human) 56890
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.