Novus Biologicals
Manufacturer Code:NBP156446
Catalog # NBP156446
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MDH1B (malate dehydrogenase 1B NAD (soluble)) The peptide sequence was selected from the middle region of MDH1B)(50ug). Peptide sequence YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.1.1.- FLJ25341 malate dehydrogenase 1B NAD (soluble) putative malate dehydrogenase 1B RP11-95H11; malate dehydrogenase 1B, NAD (soluble); Putative malate dehydrogenase 1B
Gene Aliases: MDH1B; RP11-95H11
UniProt ID: (Human) Q5I0G3
Entrez Gene ID: (Human) 130752
Molecular Function: dehydrogenase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.