Novus Biologicals
Manufacturer Code:NBP233708
Catalog # NBP233708
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cytoplasmic Cytosolic malate dehydrogenase malate dehydrogenase 1 NAD (soluble) MDHA MDH-s MGC:1375 MOR2 soluble malate dehydrogenase; Cytosolic malate dehydrogenase; Diiodophenylpyruvate reductase; epididymis secretory protein Li 32; malate dehydrogenase 1, NAD (soluble); Malate dehydrogenase, cytoplasmic; soluble malate dehydrogenase
Gene Aliases: HEL-S-32; MDH-s; MDH1; MDHA; MGC:1375; MOR2
UniProt ID: (Human) P40925
Entrez Gene ID: (Human) 4190
Molecular Function:
dehydrogenase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.