Novus Biologicals
Manufacturer Code:NBP154797
Catalog # NBP154797
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MDH1(malate dehydrogenase 1 NAD (soluble)) The peptide sequence was selected from the middle region of MDH1. Peptide sequence NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cytoplasmic Cytosolic malate dehydrogenase malate dehydrogenase 1 NAD (soluble) MDHA MDH-s MGC:1375 MOR2 soluble malate dehydrogenase; Cytosolic malate dehydrogenase; Diiodophenylpyruvate reductase; epididymis secretory protein Li 32; malate dehydrogenase 1, NAD (soluble); Malate dehydrogenase, cytoplasmic; soluble malate dehydrogenase
Gene Aliases: HEL-S-32; MDH-s; MDH1; MDHA; MGC:1375; MOR2
UniProt ID: (Human) P40925
Entrez Gene ID: (Human) 4190
Molecular Function: dehydrogenase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.