Novus Biologicals
Manufacturer Code:NBP159885
Catalog # NBP159885
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC16A8(solute carrier family 16 member 8 (monocarboxylic acid transporter 3)) The peptide sequence was selected from the middle region of SLC16A8. Peptide sequence RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: MCT 3; MCT3MCT 3 monocarboxylate transporter 3 REMP solute carrier 16 (monocarboxylic acid transporters) member 8 Solute carrier family 16 member 8 solute carrier family 16 member 8 (monocarboxylic acid transporter 3); Monocarboxylate transporter 3; solute carrier 16 (monocarboxylic acid transporters), member 8; solute carrier family 16 (monocarboxylate transporter), member 8; Solute carrier family 16 member 8; solute carrier family 16, member 8 (monocarboxylic acid transporter 3)
Gene Aliases: MCT3; REMP; SLC16A8
UniProt ID: (Human) O95907
Entrez Gene ID: (Human) 23539
Molecular Function: transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.