Novus Biologicals
Manufacturer Code:NBP159879
Catalog # NBP159879
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC16A1(solute carrier family 16 member 1 (monocarboxylic acid transporter 1)) The peptide sequence was selected from the middle region of SLC16A1. Peptide sequence EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ36745 HHF7 MCT MCT 1 MCT1MGC44475 member 1 monocarboxylate transporter 1 Solute carrier family 16 member 1 solute carrier family 16 member 1 (monocarboxylic acid transporter 1); MCT 1; Monocarboxylate transporter 1; solute carrier family 16 (monocarboxylate transporter), member 1; solute carrier family 16 (monocarboxylic acid transporters), member 1; Solute carrier family 16 member 1; solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
Gene Aliases: HHF7; MCT; MCT1; MCT1D; SLC16A1
UniProt ID: (Human) Q9NSJ9
Entrez Gene ID: (Human) 6566
Molecular Function: transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.