Novus Biologicals
Manufacturer Code:NBP169610
Catalog # NBP169610
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LENG4 The peptide sequence was selected from the C terminal of LENG4. Peptide sequence LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-acylglycerophosphatidylinositol O-acyltransferase; 1-acylglycerophosphatidylinositol O-acyltransferase BB1LPLAT 7 Bladder and breast carcinoma-overexpressed gene 1 protein EC 2.3.1.- EC 2.3.1.n4 h-mboa-7 hMBOA-7 LENG4FLJ41296 leukocyte receptor cluster (LRC) member 4 Leukocyte receptor cluster member 4 LPIATO-acyltransferase domain-containing protein 7 LRC4 Lysophosphatidylinositol acyltransferase lysophospholipid acyltransferase 7 Lyso-PI acyltransferase malignant cell expression-enhanced gene/tumor progression-enhanced MBOA7 membrane bound O-acyltransferase domain containing 7 Membrane-bound O-acyltransferase domain-containing protein 7 OACT7; Bladder and breast carcinoma-overexpressed gene 1 protein; h-mboa-7; leukocyte receptor cluster (LRC) member 4; Leukocyte receptor cluster member 4; LPIAT; LPLAT 7; lyso-PI acyltransferase; Lysophosphatidylinositol acyltransferase; Lysophospholipid acyltransferase 7; malignant cell expression-enhanced gene/tumor progression-enhanced; Membrane-bound O-acyltransferase domain-containing protein 7; O-acyltransferase domain-containing protein 7
Gene Aliases: BB1; hMBOA-7; LENG4; LPIAT; LRC4; MBOA7; MBOAT7; OACT7
UniProt ID: (Human) Q96N66
Entrez Gene ID: (Human) 79143
Molecular Function:
acetyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.