Novus Biologicals
Manufacturer Code:NBP15525820UL
Catalog # NBP15525820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MBOAT1(membrane bound O-acyltransferase domain containing 1) The peptide sequence was selected from the N terminal of MBOAT1. Peptide sequence AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-acylglycerophosphocholine O-acyltransferase; 1-acylglycerophosphoethanolamine O-acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; 1-acylglycerophosphoserine O-acyltransferase MBOAT1; dJ434O11.1 EC 2.3.1.- EC 2.3.1.n61-acylglycerophosphoserine O-acyltransferase LPEAT1 LPLAT 1 LPSAT lysophosphatidylethanolamine acyltransferase 1 Lysophosphatidylserine acyltransferase lysophospholipid acyltransferase 1 Lyso-PS acyltransferase membrane bound O-acyltransferase domain containing 1 Membrane-bound O-acyltransferase domain-containing protein 1 MGC44669 OACT1 O-acyltransferase (membrane bound) domain containing 1 O-acyltransferase domain-containing protein 1; LPLAT 1; LPSAT; lyso-PS acyltransferase; lysophosphatidylethanolamine acyltransferase 1; Lysophosphatidylserine acyltransferase; Lysophospholipid acyltransferase 1; Membrane-bound O-acyltransferase domain-containing protein 1; O-acyltransferase (membrane bound) domain containing 1; O-acyltransferase domain-containing protein 1
Gene Aliases: dJ434O11.1; LPEAT1; LPLAT; LPLAT 1; LPSAT; MBOAT1; OACT1
UniProt ID: (Human) Q6ZNC8
Entrez Gene ID: (Human) 154141
Molecular Function: acetyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.