Novus Biologicals
Manufacturer Code:NBP238704
Catalog # NBP238704
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CARD adapter inducing interferon beta; CARD adapter inducing interferon beta CARD adapter inducing interferon-beta CARD adaptor inducing IFN-beta CARDIF DKFZp547C224 DKFZp666M015 FLJ27482 IFN-B promoter stimulator 1 Interferon beta promoter stimulator protein 1 interferon-beta promoter stimulator protein 1 IPS-1FLJ41962 IPS1MGC3260 KIAA1271FLJ35386 mitochondrial antiviral signaling protein mitochondrial antiviral-signaling protein mitochondrial viral signaling protein Putative NF-kappa-B-activating protein 031N virus-induced signaling adapter variant 1b virus-induced signaling adaptor variant 1a Virus-induced-signaling adapter VISAFLJ38051; CARD adaptor inducing IFN-beta; Cardif; IFN-B promoter stimulator 1; Interferon beta promoter stimulator protein 1; IPS-1; MAVS; Mitochondrial antiviral-signaling protein; Putative NF-kappa-B-activating protein 031N; virus-induced signaling adaptor; Virus-induced-signaling adapter; VISA
Gene Aliases: CARDIF; IPS-1; IPS1; KIAA1271; MAVS; VISA
UniProt ID: (Human) Q7Z434
Entrez Gene ID: (Human) 57506
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.