Novus Biologicals
Manufacturer Code:NBP187909
Catalog # NBP187909
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hMATE-1; hMATE-1 MATE-1 MATE1FLJ10847multidrug and toxin extrusion 1 MGC64822 multidrug and toxin extrusion protein 1 Solute carrier family 47 member 1 solute carrier family 47 member 1; MATE-1; multidrug and toxin extrusion 1; Multidrug and toxin extrusion protein 1; solute carrier family 47 (multidrug and toxin extrusion), member 1; Solute carrier family 47 member 1; solute carrier family 47, member 1
Gene Aliases: MATE1; SLC47A1
UniProt ID: (Human) Q96FL8
Entrez Gene ID: (Human) 55244
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.