Novus Biologicals
Manufacturer Code:NBP182798
Catalog # NBP182798
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: beta regulatory subunit of methionine adenosyltransferase; beta regulatory subunit of methionine adenosyltransferase DTDP-4-keto-6-deoxy-D-glucose 4-reductase MAT II beta MAT-II MATIIbeta methionine adenosyltransferase 2 subunit beta Methionine adenosyltransferase II beta methionine adenosyltransferase II beta MGC12237 Nbla02999 putative protein product of Nbla02999 SDR23E1 short chain dehydrogenase/reductase family 23E member 1 TGR; dTDP-4-keto-6-deoxy-D-glucose 4-reductase; MAT II beta; Methionine adenosyltransferase 2 subunit beta; Methionine adenosyltransferase II beta; methionine adenosyltransferase II, beta; Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase; putative protein product of Nbla02999; short chain dehydrogenase/reductase family 23E, member 1; testicular tissue protein Li 118
Gene Aliases: MAT-II; MAT2B; MATIIbeta; MSTP045; Nbla02999; SDR23E1; TGR; UNQ2435/PRO4995
UniProt ID: (Human) Q9NZL9
Entrez Gene ID: (Human) 27430
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.