Novus Biologicals
Manufacturer Code:NBP154893
Catalog # NBP154893
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MAT1A(methionine adenosyltransferase I alpha) The peptide sequence was selected from the C terminal of MAT1A. Peptide sequence VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AdoMet synthase 1; AdoMet synthase 1 adoMet synthetase 1 AMS1 MAT MATA1MAT 1 MAT-I/III Methionine adenosyltransferase 1 methionine adenosyltransferase I alpha Methionine adenosyltransferase I/III S-adenosylmethionine synthase isoform type-1 S-adenosylmethionine synthetase isoform type-1 SAMS SAMS1EC 2.5.1.6; adoMet synthetase 1; MAT 1; MAT-I/III; Methionine adenosyltransferase 1; methionine adenosyltransferase I, alpha; Methionine adenosyltransferase I/III; S-adenosylmethionine synthase isoform type-1; S-adenosylmethionine synthetase isoform type-1
Gene Aliases: AMS1; MAT; MAT1A; MATA1; SAMS; SAMS1
UniProt ID: (Human) Q00266
Entrez Gene ID: (Human) 4143
Molecular Function:
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.