Novus Biologicals
Manufacturer Code:NBP15536120UL
Catalog # NBP1553620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ENOPH1(enolase-phosphatase 1) Antibody(against the N terminal of ENOPH1. Peptide sequence IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2,3-diketo-5-methylthio-1-phosphopentane phosphatase; acireductone synthase; acireductone synthase DKFZp586M0524 E1 EC 3.1.3.77 enolase-phosphatase 1 enolase-phosphatase E1 MASA homolog MASAFLJ12594 MST14523-diketo-5-methylthio-1-phosphopentane phosphatase; Enolase-phosphatase E1; ENOPH1; MASA homolog
Gene Aliases: E1; ENOPH1; MASA; MST145; MSTP145; mtnC
UniProt ID: (Human) Q9UHY7
Entrez Gene ID: (Human) 58478
Molecular Function:
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.