Novus Biologicals
Manufacturer Code:NBP183442
Catalog # NBP183442
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11 EC 2.7.11.1 FLJ12177 FLJ90097 KIAA1860MARK4L MAP/microtubule affinity-regulating kinase 4 MAP/microtubule affinity-regulating kinase like 1 MAP/microtubule affinity-regulating kinase-like 1 MARK4 serine/threonine protein kinase MARKL1L MARKL1MARK4S Nbla00650; MAP/microtubule affinity-regulating kinase 4; MAP/microtubule affinity-regulating kinase like 1; MAP/microtubule affinity-regulating kinase-like 1; MARK4 serine/threonine protein kinase
Gene Aliases: KIAA1860; MARK4; MARK4L; MARK4S; MARKL1; MARKL1L; PAR-1D
UniProt ID: (Human) Q96L34
Entrez Gene ID: (Human) 57787
Molecular Function:
kinase
non-receptor serine/threonine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.