Novus Biologicals
Manufacturer Code:NBP238164
Catalog # NBP238164
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSSPQRASGPNRHQAPSMLSPGPALSSDSDKEGEDEGTEEELPALPVLAKSTKKALASVPSPALPRSLSHWEMSRAQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AOA1EAOH AOAMGC1072 aprataxin ataxia 1 early onset with hypoalbuminemia AXA1 EC 3.- EOAHA FHA-HIT FLJ20157 Forkhead-associated domain histidine triad-like protein; JNK-binding protein 1; JNKBP-1; mitogen activated protein kinase binding protein 1; Mitogen-activated protein kinase-binding protein 1
Gene Aliases: JNKBP-1; JNKBP1; KIAA0596; MAPKBP1
UniProt ID: (Human) O60336
Entrez Gene ID: (Human) 23005
Molecular Function:
RNA binding protein
enzyme modulator
esterase
hydrolase
kinase inhibitor
kinase modulator
mRNA processing factor
mRNA splicing factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.