Novus Biologicals
Manufacturer Code:NBP258000
Catalog # NBP258000
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DLK; DLKEC 2.7.11.25 Dual leucine zipper bearing kinase EC 2.7.11 Leucine-zipper protein kinase MAPK-upstream kinase MEKK12 mitogen-activated protein kinase kinase kinase 12 Mixed lineage kinase MUKdual leucine zipper kinase DLK protein kinase MUK ZPKleucine zipper protein kinase ZPKP1; Dual leucine zipper bearing kinase; dual leucine zipper kinase DLK; leucine zipper protein kinase; Leucine-zipper protein kinase; MAPK-upstream kinase; Mitogen-activated protein kinase kinase kinase 12; Mixed lineage kinase; MUK; protein kinase MUK; ZPK
Gene Aliases: DLK; MAP3K12; MEKK12; MUK; ZPK; ZPKP1
UniProt ID: (Human) B3KSS9
Entrez Gene ID: (Human) 7786
Molecular Function:
kinase
non-receptor serine/threonine protein kinase
non-receptor tyrosine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.