Test
Novus Biologicals
Manufacturer Code:NBP256021
Catalog # NBP256021
Quantity:
Shared lists are a new way to save products. Create a list for each of your projects to share with collaborators like your lab manager. Then select and buy products as a team.
![]()
Creating a shared list
Click "Save to list" to create your first list, give it a name, and add the product. Access your shared lists in the Account link on Thermofisher.com. |
![]()
Collaborate
You can invite collaborators like your lab manager or procurement staff to any shared list. They can add more items, leave comments and complete the final purchase. |
![]()
Export as a spreadsheet
Export your list as a spreadsheet for easy documentation or hand off to your lab’s designated buyer. |
Shared lists are a new way to save products. Create a list for each of your projects to share with collaborators like your lab manager. Then select and buy products as a team.
Click "Save to list" to create your first list, give it a name, and add the product. Access your shared lists in the Account link on Thermofisher.com.
You can invite collaborators like your lab manager or procurement staff to any shared list. They can add more items, leave comments and complete the final purchase.
Export your list as a spreadsheet for easy documentation or hand off to your lab’s designated buyer.
Shared lists are a new way to save products. Create a list for each of your projects to share with collaborators like your lab manager. Then select and buy products as a team.
![]()
Creating a shared list
Click "Save to list" to create your first list, give it a name, and add the product. Access your shared lists in the Account link on Thermofisher.com. |
![]()
Collaborate
You can invite collaborators like your lab manager or procurement staff to any shared list. They can add more items, leave comments and complete the final purchase. |
Export your list as a spreadsheet for easy documentation or hand off to your lab’s designated buyer.
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FYYSWYGSPRREGHYIHWDHVMVPHWDPKISASY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.2.1.- EC 3.2.1.130 FLJ31434 glycoprotein endo-alpha-12-mannosidase-like protein mannosidase endo-alpha-like MGC78681 RP11-109P14.3; Glycoprotein endo-alpha-1,2-mannosidase-like protein; mannosidase, endo-alpha-like
Gene Aliases: MANEAL
UniProt ID: (Human) Q5VSG8
Entrez Gene ID: (Human) 149175
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.