Novus Biologicals
Manufacturer Code:NBP214217
Catalog # NBP214217
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QSQVRAQREKIKEMMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFGGLSG ATVIDSLDTLYLMELKEEFQEAKAWVGESFHLNVSG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1,2-alpha-mannosidase IC; 12-alpha-mannosidase IC Alpha-12-mannosidase IC EC 3.2.1.113 HMICProcessing alpha-12-mannosidase IC MAN1A3 MAN1C Mannosidase alpha class 1C member 1 mannosidase alpha class 1C member 1 mannosyl-oligosaccharide 12-alpha-mannosidase IC pp6318; Alpha-1,2-mannosidase IC; HMIC; Mannosidase alpha class 1C member 1; mannosidase, alpha, class 1C, member 1; Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC; Processing alpha-1,2-mannosidase IC
Gene Aliases: HMIC; MAN1A3; MAN1C; MAN1C1; pp6318
UniProt ID: (Human) Q9NR34
Entrez Gene ID: (Human) 57134
Molecular Function: chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.