Novus Biologicals
Manufacturer Code:NBP160058
Catalog # NBP160058
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MAN1A2(mannosidase alpha class 1A member 2) The peptide sequence was selected from the middle region of MAN1A2. Peptide sequence FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha-1,2-mannosidase IB; Alpha-12-mannosidase IB EC 3.2.1.113 MAN1Balpha12-mannosidase Mannosidase alpha class 1A member 2 mannosidase alpha class 1A member 2 mannosyl-oligosaccharide 12-alpha-mannosidase IB Processing alpha-12-mannosidase IB; alpha1,2-mannosidase; Mannosidase alpha class 1A member 2; mannosidase, alpha, class 1A, member 2; Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB; Processing alpha-1,2-mannosidase IB
Gene Aliases: MAN1A2; MAN1B
UniProt ID: (Human) O60476
Entrez Gene ID: (Human) 10905
Molecular Function:
chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.