Novus Biologicals
Manufacturer Code:NBP169683
Catalog # NBP169683
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RP11-217H1.1 The peptide sequence was selected from the N terminal of RP11-217H1.1 (NP_115497). Peptide sequence ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA217H1.1 DKFZp564K142 FLJ14726 IAG2 IAPPRO0756 Implantation-associated protein magnesium transporter 1 magnesium transporter protein 1 MagT1 MGC64926 MRX95 oligosaccharyltransferase 3 homolog B OST3B; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; IAP; Implantation-associated protein; Magnesium transporter protein 1; MagT1; Oligosaccharyl transferase subunit MAGT1; oligosaccharyltransferase 3 homolog B
Gene Aliases: bA217H1.1; IAG2; IAP; MAGT1; MRX95; OST3B; PRO0756; PSEC0084; UNQ628/PRO1244; XMEN
UniProt ID: (Human) Q9H0U3
Entrez Gene ID: (Human) 84061
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.