Novus Biologicals
Manufacturer Code:NBP157674
Catalog # NBP157674
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MAGEA10(melanoma antigen family A 10) The peptide sequence was selected from the middle region of MAGEA10. Peptide sequence GSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cancer/testis antigen 1.10; Cancer/testis antigen 1.10 CT1.10member 10 MAGE-10 antigen melanoma antigen family A 10 melanoma-associated antigen 10; cancer/testis antigen family 1, member 10; CT1.10; MAGE-10 antigen; melanoma antigen family A, 10; melanoma antigen family A10; Melanoma-associated antigen 10
Gene Aliases: CT1.10; MAGE10; MAGEA10
UniProt ID: (Human) P43363
Entrez Gene ID: (Human) 4109
Molecular Function:
cell adhesion molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.