Novus Biologicals
Manufacturer Code:NBP181277
Catalog # NBP181277
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSLLFEGCSNSKPVNAAGRYFNSKVPITRTKS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.3.48 Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP Lymphoid phosphatase lymphoid-specific protein tyrosine phosphatase LYP Lyp1 LYP2 PEP PEST-domain phosphatase protein tyrosine phosphatase non-receptor type 22 (lymphoid) protein tyrosine phosphatase non-receptor type 8 PTPN8LYP1 tyrosine-protein phosphatase non-receptor type 22; Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP; Lymphoid phosphatase; lymphoid-specific protein tyrosine phosphatase; LyP; PEP; PEST-domain phosphatase; protein tyrosine phosphatase, non-receptor type 22 (lymphoid); protein tyrosine phosphatase, non-receptor type 8; Tyrosine-protein phosphatase non-receptor type 22
Gene Aliases: LYP; LYP1; LYP2; PEP; PTPN22; PTPN8
UniProt ID: (Human) Q9Y2R2
Entrez Gene ID: (Human) 26191
Molecular Function:
hydrolase
phosphatase
protein phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.