Novus Biologicals
Manufacturer Code:NBP247397
Catalog # NBP247397
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acid cholesteryl ester hydrolase; Acid cholesteryl ester hydrolase Cholesteryl esterase EC 3.1.1 EC 3.1.1.13 LALCESDcholesterol ester hydrolase Lipase A lipase A lysosomal acid cholesterol esterase lysosomal acid lipase lysosomal acid lipase/cholesteryl ester hydrolase Sterol esterase; cholesterol ester hydrolase; Cholesteryl esterase; Lipase A; lipase A, lysosomal acid, cholesterol esterase; lysosomal acid lipase; Lysosomal acid lipase/cholesteryl ester hydrolase; Sterol esterase
Gene Aliases: CESD; LAL; LIPA
UniProt ID: (Human) P38571
Entrez Gene ID: (Human) 3988
Molecular Function:
hydrolase
lipase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.