Novus Biologicals
Manufacturer Code:NBP198488
Catalog # NBP198488
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is FUT3/Blood Group Lewis A - C-terminal region. Peptide sequence: RSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3; alpha-(1,3/1,4)-fucosyltransferase; alpha-(13/14)-fucosyltransferase Blood group Lewis alpha-4-fucosyltransferase CD174 EC 2.4.1 EC 2.4.1.65 FT3B Fucosyltransferase 3 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase Lewis blood group) Fucosyltransferase III FucT-III galactoside 3(4)-L-fucosyltransferase LEfucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase Lewis blood groupincluded) Les Lewis FT MGC131739; Alpha-3-fucosyltransferase FUT3; Blood group Lewis alpha-4-fucosyltransferase; Fucosyltransferase 3; fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group); Fucosyltransferase III; FucT-III; Lewis FT
Gene Aliases: CD174; FT3B; FucT-III; FUT3; LE; Les
UniProt ID: (Human) P21217
Entrez Gene ID: (Human) 2525
Molecular Function: glycosyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.