Novus Biologicals
Manufacturer Code:NBP15932020UL
Catalog # NBP15932020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LEP(leptin) The peptide sequence was selected form the N terminal of LEP. Peptide sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ94114 leptin leptin (murine obesity homolog) leptin (obesity homolog mouse) Obese protein obese mouse homolog of Obesity factor OBOBS; Leptin; leptin (murine obesity homolog); leptin (obesity homolog, mouse); Obese protein; obese, mouse, homolog of; Obesity factor
Gene Aliases: LEP; LEPD; OB; OBS
UniProt ID: (Human) P41159
Entrez Gene ID: (Human) 3952
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.