Novus Biologicals
Manufacturer Code:NBP179806
Catalog # NBP179806
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human LTBP1The immunogen for this antibody is LTBP1. Peptide sequence NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: latent transforming growth factor beta binding protein 1 latent-transforming growth factor beta-binding protein 1 LTBP-1 MGC163161 TGF-beta1-BP-1 Transforming growth factor beta-1-binding protein 1; Latent-transforming growth factor beta-binding protein 1; LTBP-1; TGF-beta1-BP-1; Transforming growth factor beta-1-binding protein 1
Gene Aliases: LTBP1
UniProt ID: (Human) Q14766
Entrez Gene ID: (Human) 4052
Molecular Function: annexin calcium-binding protein calmodulin cell adhesion molecule extracellular matrix glycoprotein extracellular matrix protein extracellular matrix structural protein intracellular calcium-sensing protein signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.