Novus Biologicals
Manufacturer Code:NBP238885
Catalog # NBP238885
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.4.21 EC 3.4.21.- GIG12 growth-inhibiting protein 12 HLF2 Lactoferrin lactotransferrin LF neutrophil lactoferrin talalactoferrin; epididymis luminal protein 110; Growth-inhibiting protein 12; Kaliocin-1; lactoferricin; Lactoferricin-H; Lactoferrin; lactoferroxin; Lactoferroxin-A; Lactoferroxin-B; Lactoferroxin-C; Lactotransferrin; Lfcin-H; neutrophil lactoferrin; Talalactoferrin
Gene Aliases: GIG12; HEL110; HLF2; LF; LTF
UniProt ID: (Human) P02788
Entrez Gene ID: (Human) 4057
Molecular Function:
hydrolase
protease
serine protease
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.