Novus Biologicals
Manufacturer Code:NBP155520
Catalog # NBP155520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LZTFL1(leucine zipper transcription factor-like 1) The peptide sequence was selected from the C terminal of LZTFL1. Peptide sequence VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ36386 leucine zipper transcription factor-like 1 leucine zipper transcription factor-like protein 1; leucine zipper transcription factor-like 1; Leucine zipper transcription factor-like protein 1
Gene Aliases: BBS17; LZTFL1
UniProt ID: (Human) Q9NQ48
Entrez Gene ID: (Human) 54585
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.