Novus Biologicals
Manufacturer Code:NBP192088
Catalog # NBP192088
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-O-acylceramide synthase; 1-O-acylceramide synthase ACSDKFZp564A0122 EC 2.3.1.43 GXVPLA2 LLPLLCAT-like lysophospholipase LPLA2group XV phospholipase A2 LYPLA3EC 2.3.1.- Lysophospholipase 3 lysophospholipase 3 (lysosomal phospholipase A2) Lysosomal phospholipase A2 phospholipase A2 group XV; ACS; LCAT-like lysophospholipase; LLPL; LPLA2; Lysophospholipase 3; lysophospholipase 3 (lysosomal phospholipase A2); Lysosomal phospholipase A and acyltransferase; Lysosomal phospholipase A2; Phospholipase A2 group XV; phospholipase A2, group XV
Gene Aliases: ACS; GXVPLA2; LLPL; LPLA2; LYPLA3; PLA2G15; UNQ341/PRO540
UniProt ID: (Human) Q8NCC3
Entrez Gene ID: (Human) 23659
Molecular Function: acyltransferase hydrolase lipase phospholipase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.