Novus Biologicals
Manufacturer Code:NBP169295
Catalog # NBP169295
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GAA(glucosidase alpha acid ) The peptide sequence was selected from the N terminal of GAA. Peptide sequence FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 70 kDa lysosomal alpha-glucosidase; 76 kDa lysosomal alpha-glucosidase; Acid maltase; Acid maltase Aglucosidase alfa EC 3.2.1.20 glucosidase alpha acid LYAG lysosomal alpha-glucosidase; Aglucosidase alfa; Lysosomal alpha-glucosidase
Gene Aliases: GAA; LYAG
UniProt ID: (Human) P10253
Entrez Gene ID: (Human) 2548
Molecular Function:
glucosidase
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.