Novus Biologicals
Manufacturer Code:NBP179694
Catalog # NBP179694
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human LUC7LThe immunogen for this antibody is LUC7L. Peptide sequence YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ10231 hLuc7B1 Luc7 LUC7 (S. cerevisiae)-like LUC7B1 LUC7L1 LUC7-LIKE LUC7-like (S. cerevisiae) putative RNA-binding protein Luc7-like 1 Putative SR protein LUC7B1 sarcoplasmic reticulum protein LUC7B1 SR+89; LUC7-like; Putative RNA-binding protein Luc7-like 1; Putative SR protein LUC7B1; sarcoplasmic reticulum protein LUC7B1; SR+89
Gene Aliases: hLuc7B1; Luc7; LUC7B1; LUC7L; LUC7L1; SR+89
UniProt ID: (Human) Q9NQ29
Entrez Gene ID: (Human) 55692
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.