Novus Biologicals
Manufacturer Code:NBP15316620UL
Catalog # NBP15316620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LSS(lanosterol synthase (23-oxidosqualene-lanosterol cyclase)) The peptide sequence was selected from the middle region of LSS. Peptide sequence KCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2,3-epoxysqualene--lanosterol cyclase; 2,3-epoxysqualene-lanosterol cyclase; EC 5.4.99.7 FLJ3501523-epoxysqualene--lanosterol cyclase FLJ39450 FLJ46393 hOSC human lanosterol synthase EC 5.4.99.710EC 5.4.99 lanosterol synthase lanosterol synthase (23-oxidosqualene-lanosterol cyclase)23-epoxysqualene-lanosterol cyclase OSCFLJ25486 Oxidosqualene--lanosterol cyclase; hOSC; Lanosterol synthase; OSC; Oxidosqualene--lanosterol cyclase
Gene Aliases: CTRCT44; LSS; OSC
UniProt ID: (Human) P48449
Entrez Gene ID: (Human) 4047
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.