Novus Biologicals
Manufacturer Code:NBP17062820UL
Catalog # NBP17062820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LRRC51(leucine rich repeat containing 51) The peptide sequence was selected from the N terminal of LRRC51. Peptide sequence MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Catechol O-methyltransferase 2; leucine rich transmembrane and 0-methyltransferase domain containing; leucine rich transmembrane and 0-methyltransferase domain containing TOMT; Leucine-rich repeat-containing protein 51; Protein LRTOMT1; Protein LRTOMT2; Transmembrane O-methyltransferase
Gene Aliases: CFAP111; COMT2; DFNB63; LRRC51; LRTOMT; PP7517; TOMT
UniProt ID: (Human) Q8WZ04
Entrez Gene ID: (Human) 220074
Molecular Function: methyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.