Novus Biologicals
Manufacturer Code:NBP183349
Catalog # NBP183349
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 130 kDa leucine-rich protein; CLONE-23970 leucine-rich PPR-motif containing mitochondrial mitochondrial leucine-rich PPR motif-containing protein; GP130; leucine-rich pentatricopeptide repeat containing; Leucine-rich PPR motif-containing protein, mitochondrial; leucine-rich PPR-motif containing; LRP 130; mitochondrial leucine-rich PPR motif-containing protein
Gene Aliases: CLONE-23970; GP130; LRP130; LRPPRC; LSFC
UniProt ID: (Human) P42704
Entrez Gene ID: (Human) 10128
Molecular Function:
RNA binding protein
kinase
nucleic acid binding
protein kinase
protein kinase receptor
receptor
serine/threonine protein kinase receptor
transferase
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.