Novus Biologicals
Manufacturer Code:NBP169362
Catalog # NBP169362
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LRPAP1(low density lipoprotein receptor-related protein associated protein 1) The peptide sequence was selected from the C terminal of LRPAP1. Peptide sequence IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 39 kDa receptor-associated protein; A2MRAPMRAP A2RAP alpha-2-macroglobulin receptor-associated protein alpha-2-macroglobulin receptor-associated protein 1 Alpha-2-MRAP HBP44 lipoprotein receptor associated protein low density lipoprotein receptor-related protein associated protein 1 Low density lipoprotein receptor-related protein-associated protein 1 low density lipoprotein-related protein-associated protein 1(alpha-2-macroglobulin receptor-associated protein 1) MGC138272 RAP; Alpha-2-macroglobulin receptor-associated protein; Alpha-2-MRAP; low density lipoprotein receptor-related protein associated protein 1; Low density lipoprotein receptor-related protein-associated protein 1; low density lipoprotein-related protein-associated protein 1 (alpha-2-macroglobulin receptor-associated protein 1); RAP
Gene Aliases: A2MRAP; A2RAP; alpha-2-MRAP; HBP44; LRPAP1; MRAP; MYP23; RAP
UniProt ID: (Human) P30533
Entrez Gene ID: (Human) 4043
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.