Novus Biologicals
Manufacturer Code:NBP157991
Catalog # NBP157991
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LRDD(leucine-rich repeats and death domain containing) The peptide sequence was selected from the N terminal of LRDD. Peptide sequence RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Leucine-rich repeat and death domain-containing protein; leucine-rich repeat and death domain-containing protein leucine-rich repeats and death domain containing MGC16925 p53-induced protein with a death domain PIDDDKFZp434D229; leucine-rich repeats and death domain containing; p53-induced death domain-containing protein 1; p53-induced protein with a death domain; PIDD-C; PIDD-CC; PIDD-N
Gene Aliases: LRDD; PIDD; PIDD1
UniProt ID: (Human) Q9HB75
Entrez Gene ID: (Human) 55367
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.