Novus Biologicals
Manufacturer Code:NBP179205
Catalog # NBP179205
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Lpcat2 - C-terminal region. Peptide sequence LGVPDLNVSGLFREIAQRDSVSYEEFKSFALKHPEYAKIFTTYLDLQTCH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-acylglycerol-3-phosphate O-acyltransferase 11; 1-acylglycerophosphocholine O-acyltransferase; 1-AGP acyltransferase 11; 1-AGPAT 11; 1-alkenylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase Acetyl-CoA:lyso-PAF acetyltransferase Acetyl-CoA:lyso-platelet-activating factor acetyltransferase acyl-CoA:lysophosphatidylcholine acyltransferase 2 acyltransferase like 1 Acyltransferase-like 1 AYTL1LysoPAFAT DKFZp686H22112 EC 2.3.1 EC 2.3.1.- EC 2.3.1.23 EC 2.3.1.671-acylglycerophosphocholine O-acyltransferase FLJ20481 LPC acyltransferase 2 LPCAT1 LPCAT-2 Lyso-PAF acetyltransferase LysoPC acyltransferase 2 lysophosphatidylcholine acyltransferase 2 lyso-platelet-activating factor (PAF) acetyltransferase; Acetyl-CoA:lyso-PAF acetyltransferase; Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; acyl-CoA:lysophosphatidylcholine acyltransferase 2; acyltransferase like 1; Acyltransferase-like 1; LPAAT-alpha; LPC acyltransferase 2; LPCAT-2; lyso-PAF acetyltransferase; lyso-platelet-activating factor (PAF) acetyltransferase; lysoPC acyltransferase 2; Lysophosphatidic acid acyltransferase alpha; Lysophosphatidylcholine acyltransferase 2
Gene Aliases: AGPAT11; AYTL1; LPCAT2; LysoPAFAT
UniProt ID: (Human) Q7L5N7
Entrez Gene ID: (Human) 54947
Molecular Function: acyltransferase annexin calcium-binding protein calmodulin intracellular calcium-sensing protein transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.