Novus Biologicals
Manufacturer Code:NBP188922
Catalog # NBP188922
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-acylglycerol-3-phosphate O-acyltransferase; 1-acylglycerophosphocholine O-acyltransferase; 1-acylglycerophosphocholine O-acyltransferase Acetyl-CoA:lyso-PAF acetyltransferase Acetyl-CoA:lyso-platelet-activating factor acetyltransferase acyl-CoA:lysophosphatidylcholine acyltransferase 1 acyltransferase like 2 Acyltransferase-like 2 AYTL2 EC 2.3.1.- EC 2.3.1.231-alkylglycerophosphocholine O-acetyltransferase EC 2.3.1.67 FLJ12443 FLJ41609 LPC acyltransferase 1 lpcat LPCAT-1 Lyso-PAF acetyltransferase lysoPAFAT LysoPC acyltransferase 1 lysophosphatidylcholine acyltransferase 1 PFAAP3 Phosphonoformate immuno-associated protein 3 regulated by phosphonoformate; 1-alkenylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; Acetyl-CoA:lyso-PAF acetyltransferase; Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; acyl-CoA:lysophosphatidylcholine acyltransferase 1; acyltransferase like 2; Acyltransferase-like 2; LPC acyltransferase 1; LPCAT-1; lyso-PAF acetyltransferase; lysoPAFAT; lysoPC acyltransferase 1; Lysophosphatidylcholine acyltransferase 1; Phosphonoformate immuno-associated protein 3; regulated by phosphonoformate
Gene Aliases: AGPAT10; AGPAT9; AYTL2; lpcat; LPCAT1; PFAAP3
UniProt ID: (Human) Q8NF37
Entrez Gene ID: (Human) 79888
Molecular Function:
acyltransferase
annexin
calcium-binding protein
calmodulin
intracellular calcium-sensing protein
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.