Novus Biologicals
Manufacturer Code:NBP170604
Catalog # NBP170604
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LOC152586 (glycosyltransferase 54 domain-containing protein) The peptide sequence was selected from the middle region of LOC152586. Peptide sequence KPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D; GlcNAcT-I Inhibitory Protein; glycosyltransferase 54 domain containing 1; glycosyltransferase 54 domain-containing protein; glycosyltransferase 54 domain-containing protein MGC43429; mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase family, member D; MGAT4 family, member D; N-acetylglucosaminyltransferase MGAT1 inhibitory protein
Gene Aliases: GnT1IP; MGAT4D
UniProt ID: (Human) A6NG13
Entrez Gene ID: (Human) 152586
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.