Novus Biologicals
Manufacturer Code:NBP258009
Catalog # NBP258009
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: LIM homeobox transcription factor 1 beta LIM homeobox transcription factor 1-beta LIM/homeobox protein 1.2 LIM/homeobox protein LMX1B LMX1.2 LMX-1.2 MGC138325 MGC142051 NPS1; LIM homeobox transcription factor 1, beta; LIM homeobox transcription factor 1-beta; LIM/homeobox protein 1.2; LIM/homeobox protein LMX1B; LMX-1.2
Gene Aliases: LMX1.2; LMX1B; NPS1
UniProt ID: (Human) O60663
Entrez Gene ID: (Human) 4010
Molecular Function: RNA binding protein actin family cytoskeletal protein cytoskeletal protein helix-turn-helix transcription factor homeobox transcription factor nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.